PDB entry 1yxj

View 1yxj on RCSB PDB site
Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) at low pH
Class: lipid binding protein
Keywords: C-type lectin-like domain, LOX-1, CTLD, Scavenger receptor, Oxidized LDL receptor, NK cell receptor, LIPID BINDING PROTEIN
Deposited on 2005-02-22, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.211
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380 (1-129)
      • initiating methionine (0)
      • modified residue (62)
      • modified residue (82)
    Domains in SCOPe 2.07: d1yxja_
  • Chain 'B':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380 (1-End)
      • modified residue (62)
      • modified residue (82)
    Domains in SCOPe 2.07: d1yxjb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxjA (A:)
    mpcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
    fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
    sicqkkanlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yxjB (B:)
    mpcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
    fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
    sicqkkanlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxjB (B:)
    pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
    wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
    icqkkanl