PDB entry 1ywk

View 1ywk on RCSB PDB site
Description: Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis
Class: isomerase
Keywords: Structural genomics, NYSGXRC target T1814, ketol-isomerase, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium
Deposited on 2005-02-18, released 2005-03-01
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
    Species: Enterococcus faecalis
    Gene: kduI1, kduI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838L9 (5-End)
      • cloning artifact (2-4)
    Domains in SCOP 1.75: d1ywka1
  • Chain 'B':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
    Species: Enterococcus faecalis
    Gene: kduI1, kduI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838L9 (5-End)
      • cloning artifact (2-4)
    Domains in SCOP 1.75: d1ywkb1
  • Chain 'C':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
    Species: Enterococcus faecalis
    Gene: kduI1, kduI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838L9 (5-End)
      • cloning artifact (3-4)
    Domains in SCOP 1.75: d1ywkc1
  • Chain 'D':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
    Species: Enterococcus faecalis
    Gene: kduI1, kduI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838L9 (5-End)
      • cloning artifact (3-4)
    Domains in SCOP 1.75: d1ywkd1
  • Chain 'E':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
    Species: Enterococcus faecalis
    Gene: kduI1, kduI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838L9 (5-End)
      • cloning artifact (2-4)
    Domains in SCOP 1.75: d1ywke1
  • Chain 'F':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1
    Species: Enterococcus faecalis
    Gene: kduI1, kduI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838L9 (5-End)
      • cloning artifact (3-4)
    Domains in SCOP 1.75: d1ywkf1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywkA (A:)
    mslqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptte
    eleiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfss
    enpdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescql
    qmgytilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaa
    ispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywkA (A:)
    lqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteel
    eiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssen
    pdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqm
    gytilepgsawntrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsg
    vgtsnysfiwamcge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ywkB (B:)
    mslqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptte
    eleiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfss
    enpdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescql
    qmgytilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaa
    ispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywkB (B:)
    lqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteel
    eiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssen
    pdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqm
    gytilepgsawntmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgv
    gtsnysfiwamcge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ywkC (C:)
    mslqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptte
    eleiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfss
    enpdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescql
    qmgytilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaa
    ispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywkC (C:)
    qnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteele
    iildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenp
    dnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmg
    ytilepgsawntrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgv
    gtsnysfiwamcg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ywkD (D:)
    mslqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptte
    eleiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfss
    enpdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescql
    qmgytilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaa
    ispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywkD (D:)
    qnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteele
    iildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenp
    dnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmg
    ytilepgsawntrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgv
    gtsnysfiwamcge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ywkE (E:)
    mslqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptte
    eleiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfss
    enpdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescql
    qmgytilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaa
    ispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywkE (E:)
    lqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteel
    eiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssen
    pdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqm
    gytilepgsawntmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgv
    gtsnysfiwamcge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ywkF (F:)
    mslqnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptte
    eleiildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfss
    enpdnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescql
    qmgytilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaa
    ispswsihsgvgtsnysfiwamcgenitytdmdmvamdqlkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywkF (F:)
    qnmetrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteele
    iildkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenp
    dnpakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmg
    ytilepgsawntmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgvg
    tsnysfiwamcge