PDB entry 1yw2

View 1yw2 on RCSB PDB site
Description: Mutated Mus Musculus P38 Kinase (mP38)
Class: transferase
Keywords: transferase
Deposited on 2005-02-16, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yw2a_
  • Heterogens: PGJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yw2A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddema
    gfvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yw2A (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgarhvatrwyrape
    imlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkiss
    esarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyh
    dpddepvadpydqsfesrdllidewksltydevisfvpppl