PDB entry 1yvg

View 1yvg on RCSB PDB site
Description: Structural analysis of the catalytic domain of tetanus neurotoxin
Class: hydrolase
Keywords: Clostridium neurotoxins; tetanus neurotoxin; zinc metalloprotease; Dual-wavelength Anomalous dispersion (DAD), HYDROLASE
Deposited on 2005-02-15, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetanus toxin, light chain
    Species: Clostridium tetani [TaxId:1513]
    Gene: tetX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yvga_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvgA (A:)
    pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
    pssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgns
    yslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivlrvdnk
    nyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalllmhelihvlhg
    lygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektlndyka
    ianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimygftei
    elgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnmrvntn
    afrnvdgsglvskliglckkiipptnirenlynrtaspptpghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvgA (A:)
    pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
    pssaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgnsysll
    dkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivlrvdnknyfp
    crdgfgsimqmafcpeyvptfdnskyfqdpalllmhelihvlhglygmqvssheipisae
    elftfggqdanlisidikndlyektlndykaianklsqvtscndpnididsykqiyqqky
    qfdkdsngqyivnedkfqilynsimygfteielgkkfniktrlsyfsmnhdpvkipnlld
    dtiyndtegfnieskdlkseykgqnmrvntnafrnvd