PDB entry 1yv1

View 1yv1 on RCSB PDB site
Description: Fully reduced state of nigerythrin (all ferrous)
Class: oxidoreductase
Keywords: Rubrerythrin, Rubredoxin, Hemerythrin, Electron Transfer, Peroxidase, Diiron center, OXIDOREDUCTASE
Deposited on 2005-02-14, released 2005-06-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nigerythrin
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Gene: ngr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30820 (0-201)
      • see remark 999 (24)
    Domains in SCOPe 2.05: d1yv1a1, d1yv1a2
  • Chain 'B':
    Compound: Nigerythrin
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Gene: ngr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30820 (0-201)
      • see remark 999 (24)
    Domains in SCOPe 2.05: d1yv1b1, d1yv1b2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yv1A (A:)
    mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
    dmypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyi
    hkgedfekcpicfrpkdtftay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yv1B (B:)
    mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
    dmypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyi
    hkgedfekcpicfrpkdtftay