PDB entry 1yuz

View 1yuz on RCSB PDB site
Description: Partially Reduced State of Nigerythrin
Class: oxidoreductase
Keywords: Rubrythrin, Rubredoxin, Hemerythrin, Electron TRansfer, Diiron Center
Deposited on 2005-02-14, released 2005-06-21
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.192
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nigerythrin
    Species: Desulfovibrio vulgaris
    Gene: ngr
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yuza1, d1yuza2
  • Chain 'B':
    Compound: Nigerythrin
    Species: Desulfovibrio vulgaris
    Gene: ngr
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yuzb1, d1yuzb2
  • Heterogens: FE, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yuzA (A:)
    mkvraqvptvknatnfnmvadsktavgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
    dmypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyi
    hkgedfekcpicfrpkdtftay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yuzA (A:)
    mkvraqvptvknatnfnmvadsktavgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvpsayscdlnlisgangeiyetsdm
    ypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyihk
    gedfekcpicfrpkdtftay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuzB (B:)
    mkvraqvptvknatnfnmvadsktavgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
    dmypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyi
    hkgedfekcpicfrpkdtftay