PDB entry 1yux

View 1yux on RCSB PDB site
Description: Mixed valant state of nigerythrin
Class: oxidoreductase
Keywords: Rubrythrin, Rubredoxin, Hemerythrin, Peroxidase, Electron Transfer, Diiron
Deposited on 2005-02-14, released 2005-06-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nigerythrin
    Species: Desulfovibrio vulgaris
    Gene: ngr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30820 (0-201)
      • see remark 999 (24)
    Domains in SCOP 1.73: d1yuxa1, d1yuxa2
  • Chain 'B':
    Compound: Nigerythrin
    Species: Desulfovibrio vulgaris
    Gene: ngr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30820 (0-201)
      • see remark 999 (24)
    Domains in SCOP 1.73: d1yuxb1, d1yuxb2
  • Heterogens: FE, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yuxA (A:)
    mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
    dmypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyi
    hkgedfekcpicfrpkdtftay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yuxA (A:)
    mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvpsayscdlnlisgangeiyetsdm
    ypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyihk
    gedfekcpicfrpkdtftay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuxB (B:)
    mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
    qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
    dmypafirkaqeegnskavhvftraklaesvhaerylaayndidapdddkfhlcpicgyi
    hkgedfekcpicfrpkdtftay