PDB entry 1yut

View 1yut on RCSB PDB site
Description: Solution structure of Calcium-S100A13 (minimized mean structure)
Class: metal binding protein
Keywords: S100A13, EF hand calcium-binding proteins, Copper(II), NMR structure, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2005-02-14, released 2005-10-18
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-18, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S100 calcium-binding protein A13
    Species: HOMO SAPIENS
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yuta1
  • Chain 'B':
    Compound: S100 calcium-binding protein A13
    Species: HOMO SAPIENS
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yutb1
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yutA (A:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yutB (B:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk