PDB entry 1yus

View 1yus on RCSB PDB site
Description: Solution structure of apo-S100A13
Class: metal binding protein
Keywords: S100A13, EF hand calcium-binding proteins, Copper(II), NMR structure, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2005-02-14, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S100 calcium binding protein A13
    Species: HOMO SAPIENS
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yusa1
  • Chain 'B':
    Compound: S100 calcium binding protein A13
    Species: HOMO SAPIENS
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yusb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yusA (A:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yusB (B:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk