PDB entry 1yuh

View 1yuh on RCSB PDB site
Description: fab fragment
Deposited on 1996-01-30, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.19
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhA (A:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpskqsnnkymassyl
    tlsarawerhasyscqvtheghtvekslsra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhB (B:)
    qvqfqqsgaelvkpgasvklsckasgytftsylmhwikqrpgrglewigridpnnvvtkf
    nekfkskatltvdkpsstaymelssltsedsavyycaryaycrpmdywgqgttvtvssaa
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdly
    tlsssvtvpastwpsgtvtcnvahpasstavdkkivpr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhH (H:)
    qvqfqqsgaelvkpgasvklsckasgytftsylmhwikqrpgrglewigridpnnvvtkf
    nekfkskatltvdkpsstaymelssltsedsavyycaryaycrpmdywgqgttvtvssaa
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdly
    tlsssvtvpastwpsgtvtcnvahpasstavdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuhL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpskqsnnkymassyl
    tlsarawerhasyscqvtheghtvekslsra