PDB entry 1yuc

View 1yuc on RCSB PDB site
Description: Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to Phospholipid and a Fragment of Human SHP
Class: transcription regulation
Keywords: Liver Receptor Homologue 1; Nuclear Receptor Ligand Binding Domain; LRH-1; Phospholipid; SHP; Small Heterodimer Partner, TRANSCRIPTION REGULATION
Deposited on 2005-02-13, released 2005-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orphan nuclear receptor NR5A2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yuca_
  • Chain 'B':
    Compound: Orphan nuclear receptor NR5A2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yucb_
  • Chain 'C':
    Compound: Nuclear receptor 0B2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear receptor 0B2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EPH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yucA (A:)
    gefmdsyqtsspasiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmc
    kmadqtlfsivewarssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflv
    tgqqvdysiiasqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlen
    fqlvegvqeqvnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdv
    pynnlliemlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yucA (A:)
    asiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsive
    warssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiias
    qagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvn
    aalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yucB (B:)
    gefmdsyqtsspasiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmc
    kmadqtlfsivewarssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflv
    tgqqvdysiiasqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlen
    fqlvegvqeqvnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdv
    pynnlliemlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yucB (B:)
    siphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivew
    arssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasq
    agatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvna
    alldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlhak
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.