PDB entry 1yu9

View 1yu9 on RCSB PDB site
Description: GppNHp-Bound Rab4A
Class: protein transport
Keywords: Rab GTPase, Rab4, vesicular trafficking, protein transport
Deposited on 2005-02-13, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.158
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: HOMO SAPIENS
    Gene: Rab4a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20338 (4-174)
      • cloning artifact (0-3)
    Domains in SCOP 1.75: d1yu9a1
  • Heterogens: MG, SO4, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yu9A (A:)
    gplgsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyv
    klqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqnivii
    lcgnkkdldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk