PDB entry 1ytj

View 1ytj on RCSB PDB site
Description: siv protease crystallized with peptide product
Class: complex (hydrolase/peptide)
Keywords: complex (hydrolase/peptide,) aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase
Deposited on 1996-08-01, released 1997-03-12
The last revision prior to the SCOP 1.75 freeze date was dated 1997-03-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: siv protease
    Species: Escherichia coli
    Gene: SIV(MAC)239
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05896 (0-97)
      • engineered (3)
      • conflict (6)
      • conflict (63)
    Domains in SCOP 1.75: d1ytja_
  • Chain 'I':
    Compound: peptide product
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ytjA (A:)
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf

  • Chain 'I':
    No sequence available.