PDB entry 1ytg

View 1ytg on RCSB PDB site
Description: siv protease crystallized with peptide product
Class: hydrolase/peptide
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase, hydrolase-peptide complex
Deposited on 1996-08-01, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: STRAIN SF-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOPe 2.06: d1ytga_
  • Chain 'B':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: STRAIN SF-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOPe 2.06: d1ytgb_
  • Chain 'I':
    Compound: peptide product
    Database cross-references and differences (RAF-indexed):
    • PDB 1YTG (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytgA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytgB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'I':
    No sequence available.