PDB entry 1ysx

View 1ysx on RCSB PDB site
Description: Solution structure of domain 3 from human serum albumin complexed to an anti-apoptotic ligand directed against Bcl-xL and Bcl-2
Class: apoptosis
Keywords: complex, apoptosis
Deposited on 2005-02-09, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Homo sapiens [TaxId:9606]
    Gene: ALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ysxa1
  • Heterogens: 4EB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ysxA (A:)
    qnlikqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeak
    rmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefna
    etftfhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddk
    etcfaeegkklvaasqaalgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysxA (A:)
    qnlikqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeak
    rmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefna
    etftfhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddk
    etcfaeegkklvaasqaalg