PDB entry 1yro

View 1yro on RCSB PDB site
Description: Crystal structure of beta14,-galactosyltransferase mutant ARG228Lys in complex with alpha-lactalbumin in the presence of UDP-galactose and Mn
Class: transferase activator/transferase
Keywords: ARG228LYS mutation; UDP-gal complex, TRANSFERASE ACTIVATOR/TRANSFERASE COMPLEX
Deposited on 2005-02-04, released 2005-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: alpha-lactalbumin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yroa_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (111)
      • engineered (225)
    Domains in SCOPe 2.06: d1yrob1
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: alpha-lactalbumin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yroc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (111)
      • engineered (225)
    Domains in SCOPe 2.06: d1yrod_
  • Heterogens: GDU, CA, MN, UDP, MES, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yroA (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yroB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnkakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yroB (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnkakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yroC (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yroD (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnkakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yroD (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnkakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps