PDB entry 1yrg

View 1yrg on RCSB PDB site
Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein
Class: transcription
Keywords: gtpase-activating protein, gap, rna1p, rangap, lrr, leucine-rich repeat protein, twinning, hemihedral twinning, merohedral twinning, merohedry, transcription
Deposited on 1999-03-29, released 2000-03-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase-activating protein rna1_schpo
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41391 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.05: d1yrga_
  • Chain 'B':
    Compound: gtpase-activating protein rna1_schpo
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41391 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.05: d1yrgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrgA (A:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmeeltdeeeedeeeeaesq
    spepetseeekedkeladelskahi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrgA (A:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrgB (B:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmeeltdeeeedeeeeaesq
    spepetseeekedkeladelskahi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrgB (B:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme