PDB entry 1yr2

View 1yr2 on RCSB PDB site
Description: Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Inter-Domain Dynamics in Catalysis and Specificity
Class: hydrolase
Keywords: prolyl endopeptidase, mechanistic study, celiac sprue, HYDROLASE
Deposited on 2005-02-02, released 2005-03-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl oligopeptidase
    Species: Novosphingobium capsulatum [TaxId:13688]
    Gene: ATCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZNM8 (Start-722)
      • see remark 999 (666)
      • cloning artifact (723-734)
      • expression tag (735-737)
    Domains in SCOPe 2.05: d1yr2a1, d1yr2a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yr2A (A:)
    mknrlwlamaaplalatpvafaqtpptlakdqampslppypaspqvplvedhfgekvsdp
    wrwleadvrtdakvaawvqaqsaytaaylkqlperaalekrmkalidyerfglpqrrgas
    vfyswnsglmnqsqllvrpadapvgtkgrvlldpntwakdgataldawaasddgrllays
    vqdggsdwrtvkfvgvadgkpladelkwvkfsglawlgndallysrfaepkegqafqaln
    ynqtvwlhrlgtpqsadqpvfatpelpkrghgasvssdgrwvvitssegtdpvntvhvar
    vtngkigpvtalipdlkaqwdfvdgvgdqlwfvsgdgaplkkivrvdlsgstprfdtvvp
    eskdnlesvgiagnrlfasyihdaksqvlafdldgkpagavslpgigsasglsgrpgdrh
    aylsfssftqpatvlaldpatakttpwepvhltfdpadfrveqvfypskdgtkvpmfivr
    rkdakgplptllygyggfnvaltpwfsagfmtwidsggafalanlrgggeygdawhdagr
    rdkkqnvfddfiaagewliangvtprhglaieggsngglligavtnqrpdlfaaaspavg
    vmdmlrfdqftagrywvddygypekeadwrvlrryspyhnvrsgvdypailvttadtddr
    vvpghsfkytaalqtaaigpkphlirietraghgsgkpidkqieetadvqaflahftglt
    prpwssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yr2A (A:)
    ppypaspqvplvedhfgekvsdpwrwleadvrtdakvaawvqaqsaytaaylkqlperaa
    lekrmkalidyerfglpqrrgasvfyswnsglmnqsqllvrpadapvgtkgrvlldpntw
    ataldawaasddgrllaysvqdggsdwrtvkfvgvadgkpladelkwvkfsglawlgnda
    llysrfaeplnynqtvwlhrlgtpqsadqpvfatpelpkrghgasvssdgrwvvitsseg
    tdpvntvhvarvtngkigpvtalipdlkaqwdfvdgvgdqlwfvsgdgaplkkivrvdls
    gstprfdtvvpeskdnlesvgiagnrlfasyihdaksqvlafdldgkpagavslpgigsa
    sglsgrpgdrhaylsfssftqpatvlaldpatakttpwepvhltfdpadfrveqvfypsk
    dgtkvpmfivrrkdakgplptllygyggfnvaltpwfsagfmtwidsggafalanlrggg
    eygdawhdagrrdkkqnvfddfiaagewliangvtprhglaieggsngglligavtnqrp
    dlfaaaspavgvmdmlrfdqftagrywvddygypekeadwrvlrryspyhnvrsgvdypa
    ilvttadtddrvvpghsfkytaalqtaaigpkphliriepidkqieetadvqaflahftg
    ltprpwssvdklaaalehhh