PDB entry 1ypu

View 1ypu on RCSB PDB site
Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 C2 Space Group
Class: immune system
Keywords: OXIDIZED LOW DENSITY LIPOPROTEIN receptor, Lox-1, CTLD, C-type lectin like domain, NK Cell receptor, IMMUNE SYSTEM
Deposited on 2005-01-31, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ypua_
  • Chain 'B':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ypub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ypuA (A:)
    rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
    syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
    cilaafsicqkkanl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypuA (A:)
    csapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyss
    fpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencila
    afsicqkkanl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypuB (B:)
    rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
    syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
    cilaafsicqkkanl