PDB entry 1ypq

View 1ypq on RCSB PDB site
Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 Dioxane Complex
Class: immune system
Keywords: Oxidized low density Lipoprotein receptor, Lox-1, CTLD, C-type lectin like domain, NK Cell receptor, IMMUNE SYSTEM
Deposited on 2005-01-31, released 2005-02-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.177
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ypqa1
  • Chain 'B':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ypqb_
  • Heterogens: DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ypqA (A:)
    rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
    syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
    cilaafsicqkkanl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypqA (A:)
    csapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyss
    fpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencila
    afsicqkkanl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypqB (B:)
    rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
    syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
    cilaafsicqkkanl