PDB entry 1ypo

View 1ypo on RCSB PDB site
Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 P3 1 21 Space Group
Class: immune system
Keywords: Oxidized Low Density Lipoprotein receptor, Lox-1,CTLD, C-type lectin like domain, NK Cell receptor, IMMUNE SYSTEM
Deposited on 2005-01-31, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ypoa_
  • Chain 'B':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380 (1-131)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ypob_
  • Chain 'C':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380 (1-131)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ypoc_
  • Chain 'D':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ypod_
  • Chain 'E':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ypoe_
  • Chain 'F':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ypof_
  • Chain 'G':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78380 (1-131)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ypog_
  • Chain 'H':
    Compound: oxidised low density lipoprotein (lectin-like) receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ypoh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ypoA (A:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypoA (A:)
    apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
    fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
    sicqkkanlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypoB (B:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypoC (C:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ypoD (D:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypoD (D:)
    apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
    fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
    sicqkkanl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ypoE (E:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypoE (E:)
    apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
    fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
    sicqkkanl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ypoF (F:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypoF (F:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypoG (G:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ypoH (H:)
    mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
    pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
    fsicqkkanlra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypoH (H:)
    apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
    fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
    sicqkkanl