PDB entry 1yok

View 1yok on RCSB PDB site
Description: crystal structure of human LRH-1 bound with TIF-2 peptide and phosphatidylglycerol
Class: transcription
Keywords: LRH-1, TIF-1, phosphatidylglycerol, TRANSCRIPTION
Deposited on 2005-01-27, released 2005-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orphan nuclear receptor NR5A2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2, B1F, CPF, FTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yoka_
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: P6L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yokA (A:)
    mkkhhhhhhlvprgsiphlilellkcepdepqvqakimaylqqeqanrskheklstfglm
    ckmadqtlfsivewarssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsifl
    vtgqqvdysiiasqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknle
    nfqlvegvqeqvnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngd
    vpynnlliemlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yokA (A:)
    siphlilellkcepdepqvqakimaylqqeqanrsklstfglmckmadqtlfsivewars
    siffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqaga
    tlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaall
    dytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.