PDB entry 1yo3

View 1yo3 on RCSB PDB site
Description: 1.65 Angstrom Structure of the Dynein Light Chain 1 from Plasmodium falciparum
Class: transport protein
Keywords: Structural Genomics Consortium, dynein light chain, microtubule, malaria, SGC, TRANSPORT PROTEIN
Deposited on 2005-01-26, released 2005-03-15
Made obsolete by 5wof on 2017-08-16

The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.179
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein light chain 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0660W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • cloning artifact (17-18)
    Domains in SCOPe 2.06: d1yo3a1, d1yo3a2
  • Chain 'B':
    Compound: dynein light chain 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0660W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • cloning artifact (17-18)
    Domains in SCOPe 2.06: d1yo3b1, d1yo3b2
  • Chain 'C':
    Compound: dynein light chain 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0660W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • cloning artifact (17-18)
    Domains in SCOPe 2.06: d1yo3c1, d1yo3c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yo3A (A:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo3A (A:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yo3B (B:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo3B (B:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yo3C (C:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo3C (C:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg