PDB entry 1ynr

View 1ynr on RCSB PDB site
Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
Class: electron transport
Keywords: helix, electron transport
Deposited on 2005-01-25, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus [TaxId:940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynra_
  • Chain 'B':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus [TaxId:940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynrb_
  • Chain 'C':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus [TaxId:940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynrc_
  • Chain 'D':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus [TaxId:940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynrd_
  • Heterogens: SO4, HEC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ynrA (A:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynrB (B:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynrB (B:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ynrC (C:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ynrD (D:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynrD (D:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsi