PDB entry 1ymy

View 1ymy on RCSB PDB site
Description: Crystal Structure of the N-Acetylglucosamine-6-phosphate deacetylase from Escherichia coli K12
Class: hydrolase
Keywords: NagA, NYSGXRC target T2187, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, HYDROLASE
Deposited on 2005-01-21, released 2005-02-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:83333]
    Gene: nagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ymya1, d1ymya2
  • Chain 'B':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Escherichia coli [TaxId:83333]
    Gene: nagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ymyb1, d1ymyb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ymyA (A:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymyA (A:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvpnfvrkpdaalvdflcenadvitkvtlapemvpaevisklan
    agivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildeadiycgii
    adglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcvdengtl
    sgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanltaftpd
    fkitktivngnevvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ymyB (B:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylak
    hpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlapemvpaev
    isklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglagaildead
    iycgiiadglhvdyanirnakrlkgdklclvtdatapaganieqfifagktiyyrnglcv
    dengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgtlaagkvanl
    taftpdfkitktivngnevvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymyB (B:)
    myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfidvql
    ngcggvqfavsvetleimqkaneksgctnylptlittsdelmkqgvrvmreylakhpnqa
    lglhlegpwlnlaalvdflcenadvitkvtlapemvpaevisklanagivvsaghsnatl
    keakagfragitfathlynampyitgrepglagaildeadiycgiiadglhvdyanirna
    krlkgdklclvtdatagssltmiegvrnlvehcgialdevlrmatlyparaigvekrlgt
    laagkvanltaftpdfkitktivngnevvtq