PDB entry 1ymw

View 1ymw on RCSB PDB site
Description: The study of reductive unfolding pathways of RNase A (Y92G mutant)
Class: hydrolase
Keywords: hydrolase
Deposited on 2005-01-21, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • engineered (91)
    Domains in SCOPe 2.08: d1ymwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymwA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskgpncaykttqankhiivacegnpyvpvhf
    dasv