PDB entry 1ymh

View 1ymh on RCSB PDB site
Description: anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W
Class: immune system
Keywords: Engineering of Crystal contacts, PpL-Fab complex, IMMUNE SYSTEM
Deposited on 2005-01-21, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab 16D9D6, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1YMH (0-219)
    Domains in SCOPe 2.07: d1ymha1, d1ymha2
  • Chain 'B':
    Compound: Fab 16D9D6, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1YMH (0-217)
    Domains in SCOPe 2.07: d1ymhb1, d1ymhb2
  • Chain 'C':
    Compound: Fab 16D9D6, light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1YMH (0-219)
    Domains in SCOPe 2.07: d1ymhc1, d1ymhc2
  • Chain 'D':
    Compound: Fab 16D9D6, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1YMH (0-217)
    Domains in SCOPe 2.07: d1ymhd1, d1ymhd2
  • Chain 'E':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ymhe_
  • Chain 'F':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ymhf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymhA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymhB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymhC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymhD (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymhE (E:)
    keevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytwdledggnhmni
    kfagk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymhF (F:)
    keevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytwdledggnhmni
    kfagk