PDB entry 1yma

View 1yma on RCSB PDB site
Description: structural characterization of heme ligation in the his64-->tyr variant of myoglobin
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1993-09-27, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
    • conflict (63)
  Domains in SCOP 1.73: d1ymaa_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ymaA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkygtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg