PDB entry 1ym7

View 1ym7 on RCSB PDB site
Description: G Protein-Coupled Receptor Kinase 2 (GRK2)
Class: transferase
Keywords: G protein, kinase, GPCR, GRK2, Beta-ARK1, TRANSFERASE
Deposited on 2005-01-20, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: 0.226
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-adrenergic receptor kinase 1
    Species: Bos taurus [TaxId:9913]
    Gene: ADRBK1, GRK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ym7a1, d1ym7a2, d1ym7a3
  • Chain 'B':
    Compound: Beta-adrenergic receptor kinase 1
    Species: Bos taurus [TaxId:9913]
    Gene: ADRBK1, GRK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ym7b1, d1ym7b2, d1ym7b3
  • Chain 'C':
    Compound: Beta-adrenergic receptor kinase 1
    Species: Bos taurus [TaxId:9913]
    Gene: ADRBK1, GRK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ym7c1, d1ym7c2, d1ym7c3
  • Chain 'D':
    Compound: Beta-adrenergic receptor kinase 1
    Species: Bos taurus [TaxId:9913]
    Gene: ADRBK1, GRK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ym7d1, d1ym7d2, d1ym7d3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ym7A (A:)
    madleavladvsylmamekskatpaaraskkillpepsirsvmqkyledrgevtfekifs
    qklgyllfrdfclkhleeakplvefyeeikkyekleteeerlvcsreifdtyimkellac
    shpfsksaiehvqghlvkkqvppdlfqpyieeicqnlrgdvfqkfiesdkftrfcqwknv
    elnihltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalner
    imlslvstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaae
    iilglehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymape
    vlqkgvaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspe
    lrsllegllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaa
    dafdigsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrleark
    ktknkqlgheedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqsl
    ltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqr
    vpkmknkprapvvelskvpliqrgsangl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ym7A (A:)
    skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
    ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
    yieeicqnlrgdvfqkfiesdkftrfcqwknvelnihltmndfsvhriigrggfgevygc
    rkadtgkmyamkcldkkrikmkqgetlalnerimlslvstgdcpfivcmsyafhtpdkls
    fildlmnggdlhyhlsqhgvfseadmrfyaaeiilglehmhnrfvvyrdlkpanilldeh
    ghvrisdlglacdfskkkphasvgthgymapevlqkgvaydssadwfslgcmlfkllrgh
    spfrqhktkdkheidrmtltmavelpdsfspelrsllegllqrdvnrrlgclgrgaqevk
    espffrsldwqmvflqkyppplipprgtkgiklldsdqelyrnfpltiserwqqevaetv
    fdtinaetdrlearkktknkqlgheedyalgkdcimhgymskmgntqwqrryfylfpnrl
    ewrgegeapqslltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelr
    dayreaqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ym7B (B:)
    madleavladvsylmamekskatpaaraskkillpepsirsvmqkyledrgevtfekifs
    qklgyllfrdfclkhleeakplvefyeeikkyekleteeerlvcsreifdtyimkellac
    shpfsksaiehvqghlvkkqvppdlfqpyieeicqnlrgdvfqkfiesdkftrfcqwknv
    elnihltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalner
    imlslvstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaae
    iilglehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymape
    vlqkgvaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspe
    lrsllegllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaa
    dafdigsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrleark
    ktknkqlgheedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqsl
    ltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqr
    vpkmknkprapvvelskvpliqrgsangl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ym7B (B:)
    skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
    ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
    yieeicqnlrgdvfqkfiesdkftrfcqwknvelnihltmndfsvhriigrggfgevygc
    rkadtgkmyamkcldkkrikmkqgetlalnerimlslvstgdcpfivcmsyafhtpdkls
    fildlmnggdlhyhlsqhgvfseadmrfyaaeiilglehmhnrfvvyrdlkpanilldeh
    ghvrisdlglacdfskkkphasvgthgymapevlqkgvaydssadwfslgcmlfkllrgh
    spfrqhktkdkheidrmtltmavelpdsfspelrsllegllqrdvnrrlgclgrgaqevk
    espffrsldwqmvflqkyppplipprgtkgiklldsdqelyrnfpltiserwqqevaetv
    fdtinaetdrlearkktknkqlgheedyalgkdcimhgymskmgntqwqrryfylfpnrl
    ewrgegeapqslltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelr
    dayreaqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ym7C (C:)
    madleavladvsylmamekskatpaaraskkillpepsirsvmqkyledrgevtfekifs
    qklgyllfrdfclkhleeakplvefyeeikkyekleteeerlvcsreifdtyimkellac
    shpfsksaiehvqghlvkkqvppdlfqpyieeicqnlrgdvfqkfiesdkftrfcqwknv
    elnihltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalner
    imlslvstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaae
    iilglehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymape
    vlqkgvaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspe
    lrsllegllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaa
    dafdigsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrleark
    ktknkqlgheedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqsl
    ltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqr
    vpkmknkprapvvelskvpliqrgsangl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ym7C (C:)
    skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
    ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
    yieeicqnlrgdvfqkfiesdkftrfcqwknvelnihltmndfsvhriigrggfgevygc
    rkadtgkmyamkcldkkrikmkqgetlalnerimlslvstgdcpfivcmsyafhtpdkls
    fildlmnggdlhyhlsqhgvfseadmrfyaaeiilglehmhnrfvvyrdlkpanilldeh
    ghvrisdlglacdfskkkphasvgthgymapevlqkgvaydssadwfslgcmlfkllrgh
    spfrqhktkdkheidrmtltmavelpdsfspelrsllegllqrdvnrrlgclgrgaqevk
    espffrsldwqmvflqkyppplipprgkgiklldsdqelyrnfpltiserwqqevaetvf
    dtinaetdrlearkktknkqlgheedyalgkdcimhgymskmgntqwqrryfylfpnrle
    wrgegeapqslltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelrd
    ayreaqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ym7D (D:)
    madleavladvsylmamekskatpaaraskkillpepsirsvmqkyledrgevtfekifs
    qklgyllfrdfclkhleeakplvefyeeikkyekleteeerlvcsreifdtyimkellac
    shpfsksaiehvqghlvkkqvppdlfqpyieeicqnlrgdvfqkfiesdkftrfcqwknv
    elnihltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalner
    imlslvstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaae
    iilglehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymape
    vlqkgvaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspe
    lrsllegllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaa
    dafdigsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrleark
    ktknkqlgheedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqsl
    ltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqr
    vpkmknkprapvvelskvpliqrgsangl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ym7D (D:)
    skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
    ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
    yieeicqnlrgdvfqkfiesdkftrfcqwknvelnihltmndfsvhriigrggfgevygc
    rkadtgkmyamkcldkkrikmkqgetlalnerimlslvstgdcpfivcmsyafhtpdkls
    fildlmnggdlhyhlsqhgvfseadmrfyaaeiilglehmhnrfvvyrdlkpanilldeh
    ghvrisdlglacdfskkkphasvgthgymapevlqkgvaydssadwfslgcmlfkllrgh
    spfrqhktkdkheidrmtltmavelpdsfspelrsllegllqrdvnrrlgclgrgaqevk
    espffrsldwqmvflqkyppplipprgtkgiklldsdqelyrnfpltiserwqqevaetv
    fdtinaetdrlearkktdyalgkdcimhgymskmgntqwqrryfylfpnrlewrgegeap
    qslltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqq