PDB entry 1ylz

View 1ylz on RCSB PDB site
Description: X-ray crystallographic structure of CTX-M-14 beta-lactamase complexed with ceftazidime-like boronic acid
Class: hydrolase
Keywords: CTX-M, beta-lactamase, transition state, ceftazidime, boronic acid, HYDROLASE
Deposited on 2005-01-19, released 2005-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.129
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-14
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ylza_
  • Chain 'B':
    Compound: beta-lactamase CTX-M-14
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ylzb_
  • Heterogens: PO4, CB4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ylzA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ylzB (B:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylzB (B:)
    avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
    qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
    tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
    twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
    naesrrdvlasaariiaegl