PDB entry 1ylw

View 1ylw on RCSB PDB site
Description: X-ray structure of CTX-M-16 beta-lactamase
Class: hydrolase
Keywords: CTX-M, beta-lactamase, anisotropy, extended-spectrum, HYDROLASE
Deposited on 2005-01-19, released 2005-04-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTX-M-16 beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ylwa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ylwA (A:)
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsggygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl