PDB entry 1ylp

View 1ylp on RCSB PDB site
Description: Atomic resolution structure of CTX-M-27 beta-lactamase
Class: hydrolase
Keywords: CTX-M, beta-lactamase, anisotropy, extended-spectrum, HYDROLASE
Deposited on 2005-01-19, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.132
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-27
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q840M4 (0-262)
      • see remark 999 (73)
    Domains in SCOPe 2.06: d1ylpa_
  • Heterogens: SUC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ylpA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl