PDB entry 1ylo

View 1ylo on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function (Possible Aminopeptidase) S2589 from Shigella flexneri 2a str. 2457T
Class: structural genomics, unknown function
Keywords: structural genomics, MCSG, hypothetical protein S2589, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics
Deposited on 2005-01-19, released 2005-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SF2450
    Species: Shigella flexneri 2a str. 2457T
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K87 (3-347)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (65)
      • modified residue (71)
      • modified residue (91)
      • modified residue (125)
      • modified residue (138)
      • modified residue (163)
      • modified residue (246)
      • modified residue (279)
      • modified residue (302)
      • modified residue (324)
    Domains in SCOP 1.75: d1yloa1, d1yloa2
  • Chain 'B':
    Compound: hypothetical protein SF2450
    Species: Shigella flexneri 2a str. 2457T
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K87 (3-347)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (65)
      • modified residue (71)
      • modified residue (91)
      • modified residue (125)
      • modified residue (138)
      • modified residue (163)
      • modified residue (246)
      • modified residue (279)
      • modified residue (302)
      • modified residue (324)
    Domains in SCOP 1.75: d1ylob1, d1ylob2
  • Chain 'C':
    Compound: hypothetical protein SF2450
    Species: Shigella flexneri 2a str. 2457T
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K87 (3-347)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (65)
      • modified residue (71)
      • modified residue (91)
      • modified residue (125)
      • modified residue (138)
      • modified residue (163)
      • modified residue (246)
      • modified residue (279)
      • modified residue (302)
      • modified residue (324)
    Domains in SCOP 1.75: d1yloc1, d1yloc2
  • Chain 'D':
    Compound: hypothetical protein SF2450
    Species: Shigella flexneri 2a str. 2457T
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K87 (3-347)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (65)
      • modified residue (71)
      • modified residue (91)
      • modified residue (125)
      • modified residue (138)
      • modified residue (163)
      • modified residue (246)
      • modified residue (279)
      • modified residue (302)
      • modified residue (324)
    Domains in SCOP 1.75: d1ylod1, d1ylod2
  • Chain 'E':
    Compound: hypothetical protein SF2450
    Species: Shigella flexneri 2a str. 2457T
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K87 (3-347)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (65)
      • modified residue (71)
      • modified residue (91)
      • modified residue (125)
      • modified residue (138)
      • modified residue (163)
      • modified residue (246)
      • modified residue (279)
      • modified residue (302)
      • modified residue (324)
    Domains in SCOP 1.75: d1yloe1, d1yloe2
  • Chain 'F':
    Compound: hypothetical protein SF2450
    Species: Shigella flexneri 2a str. 2457T
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K87 (3-347)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (60)
      • modified residue (65)
      • modified residue (71)
      • modified residue (91)
      • modified residue (125)
      • modified residue (138)
      • modified residue (163)
      • modified residue (246)
      • modified residue (279)
      • modified residue (302)
      • modified residue (324)
    Domains in SCOP 1.75: d1ylof1, d1ylof2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yloA (A:)
    snamdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkv
    micahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqg
    ndvsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtl
    lrelhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhr
    qigngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvpt
    lvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yloA (A:)
    amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi
    cahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgnd
    vsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllr
    elhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhrqi
    gngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvptlv
    mgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yloB (B:)
    snamdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkv
    micahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqg
    ndvsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtl
    lrelhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhr
    qigngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvpt
    lvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yloB (B:)
    amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi
    cahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgnd
    vsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllr
    elhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhrqi
    gngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvptlv
    mgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yloC (C:)
    snamdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkv
    micahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqg
    ndvsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtl
    lrelhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhr
    qigngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvpt
    lvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yloC (C:)
    amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi
    cahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgnd
    vsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllr
    elhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhrqi
    gngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvptlv
    mgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yloD (D:)
    snamdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkv
    micahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqg
    ndvsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtl
    lrelhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhr
    qigngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvpt
    lvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yloD (D:)
    amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi
    cahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgnd
    vsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllr
    elhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhrqi
    gngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvptlv
    mgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yloE (E:)
    snamdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkv
    micahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqg
    ndvsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtl
    lrelhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhr
    qigngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvpt
    lvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yloE (E:)
    amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi
    cahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgnd
    vsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllr
    elhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhrqi
    gngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvptlv
    mgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yloF (F:)
    snamdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkv
    micahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqg
    ndvsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtl
    lrelhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhr
    qigngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvpt
    lvmgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yloF (F:)
    amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi
    cahmdevgfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgnd
    vsamrvdigartydevmqagirpgdrvtfdttfqvlphqrvmgkafddrlscyllvtllr
    elhdaelpaevwlvassseevglrggqtatravspdvaivldtacwaknfdygaanhrqi
    gngpmlvlsdksliappkltawietvaaeigvplqadmfsnggtdggavhltgtgvptlv
    mgpatrhghcaasiadcrdilqmeqllsaliqrltretvvqltdfr