PDB entry 1yll

View 1yll on RCSB PDB site
Description: Crystal Structure of the Conserved Protein of Unknown Function PA5104 from Pseudomonas aeruginosa PAO1
Class: structural genomics, unknown function
Keywords: Conserved hypothetical protein, Structural Genomics, beta-barrels, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-01-19, released 2005-03-01
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.199
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Pseudomonas aeruginosa PAO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU79 (Start-197)
      • modified residue (16)
      • modified residue (72)
    Domains in SCOP 1.75: d1ylla1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Pseudomonas aeruginosa PAO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU79 (Start-197)
      • modified residue (16)
      • modified residue (72)
      • cloning artifact (198)
    Domains in SCOP 1.75: d1yllb1
  • Chain 'C':
    Compound: conserved hypothetical protein
    Species: Pseudomonas aeruginosa PAO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU79
      • modified residue (16)
      • modified residue (72)
    Domains in SCOP 1.75: d1yllc1
  • Chain 'D':
    Compound: conserved hypothetical protein
    Species: Pseudomonas aeruginosa PAO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU79 (Start-197)
      • modified residue (16)
      • modified residue (72)
      • cloning artifact (198)
    Domains in SCOP 1.75: d1ylld1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yllA (A:)
    ghmselrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfag
    yqriisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrh
    rarlqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhw
    rltahepawvcaveldslgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yllA (A:)
    selrilravdyprmpgsteeiardggdgldgfgwrlsiadvgesggfsgfagyqriisvl
    egggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlr
    vegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepa
    wvcaveldsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yllB (B:)
    ghmselrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfag
    yqriisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrh
    rarlqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhw
    rltahepawvcaveldslgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yllB (B:)
    elrilravdyprmpwkngagsteeiardgfgwrlsiadvgesggfsgfagyqriisvleg
    ggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlrve
    geldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepawv
    caveldslg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yllC (C:)
    ghmselrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfag
    yqriisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrh
    rarlqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhw
    rltahepawvcaveldslgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yllC (C:)
    selrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqr
    iisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrar
    lqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlt
    ahepawvcavelds
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yllD (D:)
    ghmselrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfag
    yqriisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrh
    rarlqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhw
    rltahepawvcaveldslgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yllD (D:)
    elrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqri
    isvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarl
    qwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlta
    hepawvcaveldslg