PDB entry 1ylh

View 1ylh on RCSB PDB site
Description: Crystal Structure of Phosphoenolpyruvate Carboxykinase from Actinobaccilus succinogenes in Complex with Manganese and Pyruvate
Class: lyase
Keywords: phosphoenolpyruvate carboxykinase, disulphide bond, bound sulfhydrl reducing agent, lyase
Deposited on 2005-01-19, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Actinobacillus succinogenes [TaxId:67854]
    Gene: pckA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ylha1, d1ylha2
  • Heterogens: MN, PO4, DT3, BME, PYR, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylhA (A:)
    mghhhhhhdydipttenlyfqgmtdlnklvkelndlgltdvkeivynpsyeqlfeeetkp
    glegfdkgtlttlgavavdtgiftgrspkdkyivcdettkdtvwwnseaakndnkpmtqe
    twkslrelvakqlsgkrlfvvegycgasekhrigvrmvtevawqahfvknmfirptdeel
    knfkadftvlngakctnpnwkeqglnsenfvafnitegiqliggtwyggemkkgmfsmmn
    yflplkgvasmhcsanvgkdgdvaiffglsgtgkttlstdpkrqligddehgwdesgvfn
    feggcyaktinlsqenepdiygairrdallenvvvradgsvdfddgsktentrvsypiyh
    idnivrpvskaghatkvifltadafgvlppvskltpeqteyyflsgftaklagtergvte
    ptptfsacfgaaflslhpiqyadvlvermkasgaeaylvntgwngtgkrisikdtrgiid
    aildgsiekaemgelpifnlaipkalpgvdpaildprdtyadkaqwqvkaedlanrfvkn
    fvkytanpeaaklvgagpka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylhA (A:)
    dlnklvkelndlgltdvkeivynpsyeqlfeeetkpglegfdkgtlttlgavavdtgift
    grspkdkyivcdettkdtvwwnseaakndnkpmtqetwkslrelvakqlsgkrlfvvegy
    cgasekhrigvrmvtevawqahfvknmfirptdeelknfkadftvlngakctnpnwkeqg
    lnsenfvafnitegiqliggtwyggemkkgmfsmmnyflplkgvasmhcsanvgkdgdva
    iffglsgtgkttlstdpkrqligddehgwdesgvfnfeggcyaktinlsqenepdiygai
    rrdallenvvvradgsvdfddgsktentrvsypiyhidnivrpvskaghatkvifltada
    fgvlppvskltpeqteyyflsgftaptptfsacfgaaflslhpiqyadvlvermkasgae
    aylvntgwngtgkrisikdtrgiidaildgsiekaemgelpifnlaipkalpgvdpaild
    prdtyadkaqwqvkaedlanrfvknfvkytanpeaaklvgagpk