SCOPe 2.06: Structural Classification of Proteins

PDB entry 1yl4

View 1yl4 on RCSB PDB site
Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
Class: ribosome
Keywords: ribosome, mRNA, translational operator
Deposited on 2005-01-19, released 2005-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 5.5 Å
R-factor: 0.307
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

Chain '1':
Compound: thrS mRNA operator
Species: synthetic, synthetic
Chain 'A':
Compound: 16s rRNA
Species: Thermus thermophilus [TaxId:300852]
Chain 'B':
Compound: tRNA PHE (unmodified bases)
Species: Thermus thermophilus [TaxId:300852]
Chain 'C':
Compound: tRNA PHE (unmodified bases)
Species: Thermus thermophilus [TaxId:300852]
Chain 'E':
Compound: 30S ribosomal protein S2
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot P80371
Domains in SCOPe 2.06: d1yl4e1
Chain 'F':
Compound: 30S ribosomal protein S3
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHP4
Domains in SCOPe 2.06: d1yl4f1, d1yl4f2
Chain 'G':
Compound: 30S ribosomal protein S4
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHR5 (Start-208)
Domains in SCOPe 2.06: d1yl4g1
Chain 'H':
Compound: 30S ribosomal protein S5
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ5
Domains in SCOPe 2.06: d1yl4h1, d1yl4h2
Chain 'I':
Compound: 30S ribosomal protein S6
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLP8 (0-100)
Domains in SCOPe 2.06: d1yl4i1
Chain 'J':
Compound: 30S ribosomal protein S7
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHN4 (Start-155)
Domains in SCOPe 2.06: d1yl4j1
Chain 'K':
Compound: 30S ribosomal protein S8
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ2 (0-137)
  - conflict (24)
  - conflict (36)
  - conflict (51)
  - conflict (60-61)
  - conflict (80)
  - conflict (87)
  - conflict (114)
Domains in SCOPe 2.06: d1yl4k1
Chain 'L':
Compound: 30S ribosomal protein S9
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SIB0 (Start-127)
Domains in SCOPe 2.06: d1yl4l1
Chain 'M':
Compound: 30S ribosomal protein S10
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHN7
Domains in SCOPe 2.06: d1yl4m1
Chain 'N':
Compound: 30S ribosomal protein S11
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot P80376 (Start-128)
Domains in SCOPe 2.06: d1yl4n1
Chain 'O':
Compound: 30S ribosomal protein S12
Species: Thermus thermophilus HB8 [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHN3
Domains in SCOPe 2.06: d1yl4o1
Chain 'P':
Compound: 30S ribosomal protein S13
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot P80377 (Start-125)
Domains in SCOPe 2.06: d1yl4p1
Chain 'Q':
Compound: 30S ribosomal protein S14
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ1 (Start-60)
Domains in SCOPe 2.06: d1yl4q1
Chain 'R':
Compound: 30S ribosomal protein S15
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SJ76 (Start-88)
Domains in SCOPe 2.06: d1yl4r1
Chain 'S':
Compound: 30S ribosomal protein S16
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SJH3 (0-End)
Domains in SCOPe 2.06: d1yl4s1
Chain 'T':
Compound: 30S ribosomal protein S17
Species: Thermus thermophilus HB8 [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHP7 (Start-104)
  - conflict (95)
Domains in SCOPe 2.06: d1yl4t1
Chain 'U':
Compound: 30S ribosomal protein S18
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLQ0 (Start-87)
Domains in SCOPe 2.06: d1yl4u1
Chain 'V':
Compound: 30S ribosomal protein S19
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHP2
Domains in SCOPe 2.06: d1yl4v1
Chain 'W':
Compound: 30S ribosomal protein S20
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SIH2 (Start-105)
  - conflict (40)
Domains in SCOPe 2.06: d1yl4w1
Chain 'X':
Compound: 30S ribosomal protein Thx
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SIH3
Domains in SCOPe 2.06: d1yl4x1

PDB Chain Sequences:

Chain '1':
No sequence available.
Chain 'A':
No sequence available.
Chain 'B':
No sequence available.
Chain 'C':
No sequence available.

Chain 'E':
Sequence, based on SEQRES records: (download)

>1yl4E (E:)
mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
eaeatetpegesevea