PDB entry 1ykw

View 1ykw on RCSB PDB site
Description: Crystal Structure of a Novel RuBisCO-Like Protein from the Green Sulfur Bacterium Chlorobium tepidum
Class: unknown function
Keywords: beta-alpha-barrel, UNKNOWN FUNCTION
Deposited on 2005-01-18, released 2005-05-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RuBisCO-like protein
    Species: Chlorobaculum tepidum [TaxId:1097]
    Gene: CT1772
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KBL4
      • engineered (327)
    Domains in SCOPe 2.05: d1ykwa1, d1ykwa2
  • Chain 'B':
    Compound: RuBisCO-like protein
    Species: Chlorobaculum tepidum [TaxId:1097]
    Gene: CT1772
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KBL4
      • engineered (327)
    Domains in SCOPe 2.05: d1ykwb1, d1ykwb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ykwA (A:)
    mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
    lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
    tyftpgvpvvklmdihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspg
    efaeiayqswlggldiakddemladvtwssieeraahlgkarrkaeaetgepkiylanit
    devdslmekhdvavrnganallinalpvglsavrmlsnytqvplighfpfiasfsrmeky
    gihskvmtklqrlagldavimpgfgdrvmtpeeevlenviectkpmgrikpclpvpggsd
    saltlqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethp
    elqamvdqsllkkqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykwA (A:)
    edvkgffasresldmeqylvldyylesvgdietalahfcseqstfrlvhaakvidyevie
    eleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmd
    ihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggl
    diakddemladvtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvav
    rnganallinalpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrla
    gldavimpgfgdrvmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgn
    vdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethpelqamvdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ykwB (B:)
    mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
    lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
    tyftpgvpvvklmdihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspg
    efaeiayqswlggldiakddemladvtwssieeraahlgkarrkaeaetgepkiylanit
    devdslmekhdvavrnganallinalpvglsavrmlsnytqvplighfpfiasfsrmeky
    gihskvmtklqrlagldavimpgfgdrvmtpeeevlenviectkpmgrikpclpvpggsd
    saltlqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethp
    elqamvdqsllkkqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykwB (B:)
    edvkgffasresldmeqylvldyylesvgdietalahfcseqstfrlvhaakvidyevie
    eleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmd
    ihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpnlspgefaeiayqswlggldi
    akddemladvtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrn
    ganallinalpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagl
    davimpgfgdrvmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvd
    fgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethpelqamvdq