PDB entry 1yk5

View 1yk5 on RCSB PDB site
Description: Pyrococcus abyssi rubredoxin
Class: Electron transport
Keywords: Electron transport
Deposited on 2005-01-17, released 2006-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.158
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yk5a_
  • Chain 'B':
    Compound: rubredoxin
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yk5b_
  • Chain 'C':
    Compound: rubredoxin
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yk5c_
  • Chain 'D':
    Compound: rubredoxin
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yk5d_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yk5A (A:)
    makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yk5B (B:)
    makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yk5C (C:)
    makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk5C (C:)
    akwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yk5D (D:)
    makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie