PDB entry 1yk4

View 1yk4 on RCSB PDB site
Description: Ultra-high resolution structure of Pyrococcus abyssi rubredoxin W4L/R5S
Class: electron transport
Keywords: electron transport
Deposited on 2005-01-17, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.69 Å
R-factor: 0.1
AEROSPACI score: 1.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V099 (0-51)
      • engineered (2-3)
    Domains in SCOPe 2.04: d1yk4a_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yk4A (A:)
    aklsckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie