PDB entry 1yjd

View 1yjd on RCSB PDB site
Description: Crystal structure of human CD28 in complex with the Fab fragment of a mitogenic antibody (5.11A1)
Class: immune system/signaling protein
Keywords: IgSF, CD28 homodimer
Deposited on 2005-01-14, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: T-cell-specific surface glycoprotein CD28
    Species: HOMO SAPIENS
    Gene: CD28
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yjdc1
  • Chain 'H':
    Compound: Fab fragment of 5.11A1 antibody heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1yjdh1
  • Chain 'L':
    Compound: Fab fragment of 5.11A1 antibody light chain
    Species: MUS MUSCULUS
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yjdC (C:)
    tgnkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqql
    qvysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk
    gkhlcpsplfpgpskplvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjdC (C:)
    nkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqqlqv
    ysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yjdH (H:)
    qvqlqqsgpelvkpgtsvrisceasgytftsyyihwvkqrpgqglewigciypgnvntny
    nekfkdkatlivdtssntaymqlsrmtsedsavyfctrshygldwnfdvwgagttvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjdH (H:)
    vqlqqsgpelvkpgtsvrisceasgytftsyyihwvkqrpgqglewigciypgnvntnyn
    ekfkdkatlivdtssntaymqlsrmtsedsavyfctrshygldwnfdvwgagttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv
    

  • Chain 'L':
    No sequence available.