PDB entry 1yjd

View 1yjd on RCSB PDB site
Description: Crystal structure of human CD28 in complex with the Fab fragment of a mitogenic antibody (5.11A1)
Class: immune system/signaling protein
Keywords: IgSF, CD28 homodimer, IMMUNE SYSTEM-SIGNALING PROTEIN COMPLEX
Deposited on 2005-01-14, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: T-cell-specific surface glycoprotein CD28
    Species: Homo sapiens [TaxId:9606]
    Gene: CD28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yjdc1
  • Chain 'H':
    Compound: Fab fragment of 5.11A1 antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YJD
    Domains in SCOPe 2.07: d1yjdh1, d1yjdh2
  • Chain 'L':
    Compound: Fab fragment of 5.11A1 antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YJD (0-211)
    Domains in SCOPe 2.07: d1yjdl1, d1yjdl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yjdC (C:)
    tgnkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqql
    qvysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk
    gkhlcpsplfpgpskplvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjdC (C:)
    nkilvkqspmlvaydnavnlsckysynlfsrefraslhkgldsavevcvvygnysqqlqv
    ysktgfncdgklgnesvtfylqnlyvnqtdiyfckievmypppyldneksngtiihvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yjdH (H:)
    qvqlqqsgpelvkpgtsvrisceasgytftsyyihwvkqrpgqglewigciypgnvntny
    nekfkdkatlivdtssntaymqlsrmtsedsavyfctrshygldwnfdvwgagttvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yjdH (H:)
    vqlqqsgpelvkpgtsvrisceasgytftsyyihwvkqrpgqglewigciypgnvntnyn
    ekfkdkatlivdtssntaymqlsrmtsedsavyfctrshygldwnfdvwgagttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yjdL (L:)
    diqmnqspsslsaslgdtititchasqniyvwlnwyqqkpgnipklliykasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqtypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn