PDB entry 1yio

View 1yio on RCSB PDB site
Description: Crystallographic structure of response regulator StyR from Pseudomonas fluorescens
Class: DNA binding protein
Keywords: Transcription regulation, DNA BINDING PROTEIN
Deposited on 2005-01-12, released 2005-09-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulatory protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yioa1, d1yioa2
  • Heterogens: HG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yioA (A:)
    mtakptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpg
    msgielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqgl
    qlnaerrqaretqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhn
    imqklnvrslanlvhlvekyesfergvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yioA (A:)
    akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpgms
    gielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqglql
    naerrqaretqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhnim
    qklnvrslanlvhlveky