PDB entry 1yic

View 1yic on RCSB PDB site
Description: the oxidized saccharomyces cerevisiae iso-1-cytochrome c, nmr, 20 structures
Deposited on 1997-02-18, released 1997-07-23
The last revision prior to the SCOP 1.71 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1yic__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yic_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase