PDB entry 1yi5

View 1yi5 on RCSB PDB site
Description: Crystal structure of the a-cobratoxin-AChBP complex
Class: toxin
Keywords: acetylcholine binding protein, snake three-fingered alpha-neurotoxin, toxin
Deposited on 2005-01-11, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.333
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5a1
  • Chain 'B':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5b1
  • Chain 'C':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5c1
  • Chain 'D':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5d1
  • Chain 'E':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5e1
  • Chain 'F':
    Compound: long neurotoxin 1
    Species: Naja siamensis [TaxId:84476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5f1
  • Chain 'G':
    Compound: long neurotoxin 1
    Species: Naja siamensis [TaxId:84476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5g1
  • Chain 'H':
    Compound: long neurotoxin 1
    Species: Naja siamensis [TaxId:84476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5h1
  • Chain 'I':
    Compound: long neurotoxin 1
    Species: Naja siamensis [TaxId:84476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5i1
  • Chain 'J':
    Compound: long neurotoxin 1
    Species: Naja siamensis [TaxId:84476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yi5j1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yi5A (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5A (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
    tysccpeayedvevslnfrkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yi5B (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5B (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttnsddseyfsqysrfeildvtqkkn
    svtysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yi5C (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5C (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
    tysccpeayedvevslnfrkkgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yi5D (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5D (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yi5E (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5E (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptnsddseyfsqysrfeildvtqkkns
    vtysccpeayedvevslnfrkkg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yi5F (F:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5F (F:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yi5G (G:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5G (G:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yi5H (H:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5H (H:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yi5I (I:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5I (I:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfpt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yi5J (J:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi5J (J:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptr