PDB entry 1yi1

View 1yi1 on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide, Tribenuron methyl
Class: Transferase
Keywords: Acetohydroxyacid synthase, acetolactate synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor, cysteine-s-dioxide, CHES, tribenuron methyl
Deposited on 2005-01-10, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.187
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase
    Species: Arabidopsis thaliana
    Gene: ILVB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17597 (0-581)
      • modified residue (254)
    Domains in SCOP 1.73: d1yi1a1, d1yi1a2, d1yi1a3
  • Heterogens: MG, 1TB, NHE, P22, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yi1A (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yi1A (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgr