PDB entry 1yhw

View 1yhw on RCSB PDB site
Description: Crystal Structure of PAK1 kinase domain with one point mutations (K299R)
Class: signaling protein, transferase
Keywords: kinase; active conformation; activation loop; ATP binding site
Deposited on 2005-01-10, released 2005-05-24
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PAK 1
    Species: HOMO SAPIENS
    Gene: PAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13153 (0-End)
      • engineered (50)
    Domains in SCOP 1.73: d1yhwa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhwA (A:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
    ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
    klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatknnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhwA (A:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
    ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
    klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeat