PDB entry 1yhm

View 1yhm on RCSB PDB site
Description: Structure of the complex of Trypanosoma cruzi farnesyl disphosphate synthase with alendronate, Isopentenyl diphosphate and mg+2
Class: transferase
Keywords: farnesyl diphosphate synthase, alendronate, isopentenyl diphosphate, mevalonate patway, geranyl transferase, dimethylallyl transferase, FPPS, TRANSFERASE
Deposited on 2005-01-09, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: TcFPPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WS26 (0-361)
      • modified residue (3)
      • modified residue (38-39)
      • modified residue (52)
      • modified residue (85)
      • modified residue (100)
      • modified residue (105)
      • modified residue (137)
      • modified residue (167)
      • modified residue (173)
      • modified residue (187)
      • modified residue (218)
      • modified residue (231)
      • modified residue (252)
    Domains in SCOPe 2.07: d1yhma_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: TcFPPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WS26 (0-361)
      • modified residue (3)
      • modified residue (38-39)
      • modified residue (52)
      • modified residue (85)
      • modified residue (100)
      • modified residue (105)
      • modified residue (137)
      • modified residue (167)
      • modified residue (173)
      • modified residue (187)
      • modified residue (218)
      • modified residue (231)
      • modified residue (252)
    Domains in SCOPe 2.07: d1yhmb_
  • Chain 'C':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: TcFPPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WS26 (0-361)
      • modified residue (3)
      • modified residue (38-39)
      • modified residue (52)
      • modified residue (85)
      • modified residue (100)
      • modified residue (105)
      • modified residue (137)
      • modified residue (167)
      • modified residue (173)
      • modified residue (187)
      • modified residue (218)
      • modified residue (231)
      • modified residue (252)
    Domains in SCOPe 2.07: d1yhmc_
  • Heterogens: MG, SO4, AHD, IPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhmA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhmB (B:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhmC (C:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk