PDB entry 1yhl

View 1yhl on RCSB PDB site
Description: Structure of the complex of Trypanosoma cruzi farnesyl diphosphate synthase with risedronate, dmapp and mg+2
Class: transferase
Keywords: farnesyl diphosphate synthase, bisphosphonate, dimethyl allyl pyrophosphate sulfate, FPPS, TRANSFERASE
Deposited on 2005-01-09, released 2005-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.177
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yhla_
  • Heterogens: MG, SO4, DMA, RIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yhlA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk