PDB entry 1yhk

View 1yhk on RCSB PDB site
Description: Trypanosoma cruzi farnesyl diphosphate synthase
Class: transferase
Keywords: farnesyl pyrophosphate synthase, farnesyl disphosphate synthase, mevalonate pathway, bisphosphonates, FPPS, TRANSFERASE
Deposited on 2005-01-09, released 2005-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yhka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhkA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhkA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr