PDB entry 1ygg

View 1ygg on RCSB PDB site
Description: Crystal structure of phosphoenolpyruvate carboxykinase from Actinobacillus succinogenes
Class: lyase
Keywords: phosphoenolpyruvate carboxykinase, LYASE
Deposited on 2005-01-04, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Actinobacillus succinogenes [TaxId:67854]
    Gene: pckA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ygga1, d1ygga2
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yggA (A:)
    mghhhhhhdydipttenlyfqgmtdlnklvkelndlgltdvkeivynpsyeqlfeeetkp
    glegfdkgtlttlgavavdtgiftgrspkdkyivcdettkdtvwwnseaakndnkpmtqe
    twkslrelvakqlsgkrlfvvegycgasekhrigvrmvtevawqahfvknmfirptdeel
    knfkadftvlngakctnpnwkeqglnsenfvafnitegiqliggtwyggemkkgmfsmmn
    yflplkgvasmhcsanvgkdgdvaiffglsgtgkttlstdpkrqligddehgwdesgvfn
    feggcyaktinlsqenepdiygairrdallenvvvradgsvdfddgsktentrvsypiyh
    idnivrpvskaghatkvifltadafgvlppvskltpeqteyyflsgftaklagtergvte
    ptptfsacfgaaflslhpiqyadvlvermkasgaeaylvntgwngtgkrisikdtrgiid
    aildgsiekaemgelpifnlaipkalpgvdpaildprdtyadkaqwqvkaedlanrfvkn
    fvkytanpeaaklvgagpka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yggA (A:)
    dlnklvkelndlgltdvkeivynpsyeqlfeeetkpglegfdkgtlttlgavavdtgift
    grspkdkyivcdettkdtvwwnseaakndnkpmtqetwkslrelvakqlsgkrlfvvegy
    cgasekhrigvrmvtevawqahfvknmfirptdeelknfkadftvlngakctnpnwkeqg
    lnsenfvafnitegiqliggtwyggemkkgmfsmmnyflplkgvasmhcsanvgkdgdva
    iffglsgtgkttlstdpkrqligddehgwdesgvfnfeggcyaktinlsqenepdiygai
    rrdallenvvvradgsvdfddgsktentrvsypiyhidnivrpvskaghatkvifltada
    fgvlppvskltpeqteyyflsgftakleptptfsacfgaaflslhpiqyadvlvermkas
    gaeaylvntgwngtgkrisikdtrgiidaildgsiekaemgelpifnlaipkalpgvdpa
    ildprdtyadkaqwqvkaedlanrfvknfvkytanpeaaklvgagpk